Class a: All alpha proteins [46456] (286 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) |
Family a.102.4.0: automated matches [227201] (1 protein) not a true family |
Protein automated matches [226931] (7 species) not a true protein |
Species Tobacco (Nicotiana tabacum) [TaxId:4097] [225865] (7 PDB entries) |
Domain d3m01a1: 3m01 A:14-220 [213107] Other proteins in same PDB: d3m01a2 automated match to d1hxga1 complexed with act, fpf, mg |
PDB Entry: 3m01 (more details), 2.6 Å
SCOPe Domain Sequences for d3m01a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m01a1 a.102.4.0 (A:14-220) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]} vrpvadfspslwgdqflsfsiknqvaekyakeiealkeqtrnmllatgmkladtlnlidt ierlgisyhfekeiddildqiynqnsncndlctsalqfrllrqhgfnispeifskfqden gkfkeslasdvlgllnlyeashvrthaddiledalafstihlesaaphlksplreqvtha leqclhkgvprvetrffissiydkeqs
Timeline for d3m01a1: