Lineage for d1ce1l2 (1ce1 L:108-211)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104585Species Therapeutic CAMPATH-1H humanized fab (rat), kappa L chain [49078] (1 PDB entry)
  8. 104587Domain d1ce1l2: 1ce1 L:108-211 [21310]
    Other proteins in same PDB: d1ce1h1, d1ce1l1

Details for d1ce1l2

PDB Entry: 1ce1 (more details), 1.9 Å

PDB Description: 1.9a structure of the therapeutic antibody campath-1h fab in complex with a synthetic peptide antigen
PDB Compounds: (L:)

SCOP Domain Sequences for d1ce1l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ce1l2 b.1.1.2 (L:108-211) Immunoglobulin (constant domains of L and H chains) {Therapeutic CAMPATH-1H humanized fab (rat), kappa L chain}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOP Domain Coordinates for d1ce1l2:

Click to download the PDB-style file with coordinates for d1ce1l2.
(The format of our PDB-style files is described here.)

Timeline for d1ce1l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ce1l1