Lineage for d1bfoh2 (1bfo H:122-216)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221126Species CAMPATH-1G igg2b monoclonal fab (rat), kappa L chain [49077] (1 PDB entry)
  8. 221134Domain d1bfoh2: 1bfo H:122-216 [21309]
    Other proteins in same PDB: d1bfoa1, d1bfob1, d1bfoc1, d1bfod1, d1bfoe1, d1bfof1, d1bfog1, d1bfoh1

Details for d1bfoh2

PDB Entry: 1bfo (more details), 2.6 Å

PDB Description: campath-1g igg2b rat monoclonal fab

SCOP Domain Sequences for d1bfoh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfoh2 b.1.1.2 (H:122-216) Immunoglobulin (constant domains of L and H chains) {CAMPATH-1G igg2b monoclonal fab (rat), kappa L chain}
aqttapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsg
lytltssvtsstwpsqtvtcnvahpasstkvdkkv

SCOP Domain Coordinates for d1bfoh2:

Click to download the PDB-style file with coordinates for d1bfoh2.
(The format of our PDB-style files is described here.)

Timeline for d1bfoh2: