Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
Protein automated matches [226907] (28 species) not a true protein |
Species Thermococcus kodakarensis [TaxId:311400] [226061] (2 PDB entries) |
Domain d3lx2c2: 3lx2 C:118-247 [213086] automated match to d1ge8a2 complexed with so4 |
PDB Entry: 3lx2 (more details), 2.4 Å
SCOPe Domain Sequences for d3lx2c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lx2c2 d.131.1.0 (C:118-247) automated matches {Thermococcus kodakarensis [TaxId: 311400]} antpeieipslpwtvkavvlagalkravkaaklvsdsiyfmatpekltfkaegndsevrt vltmedpglldlehkmtkaksaygvayledilrsladadeviirfgfdiplllkymvrda gevsfliapr
Timeline for d3lx2c2:
View in 3D Domains from other chains: (mouse over for more information) d3lx2a1, d3lx2a2, d3lx2b1, d3lx2b2 |