SCOPe 2.08: Domain d3lx2a2: 3lx2 A:118-248

Lineage for d3lx2a2 (3lx2 A:118-248)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (28 species)
   not a true protein

7. Species Thermococcus kodakarensis [TaxId:311400] [226061] (2 PDB entries)

8. Domain d3lx2a2: 3lx2 A:118-248 [213082]
   automated match to d1ge8a2
   complexed with so4

Details for d3lx2a2

PDB Entry: 3lx2, 2.4 Å

PDB Description: Crystal Structure analysis of PCNA from Thermococcus kodakaraensis tk0582

PDB Compounds: (A:) DNA polymerase sliding clamp 2

SCOPe Domain Sequences for d3lx2a2:

Sequence; same for both SEQRES and ATOM records:

>d3lx2a2 d.131.1.0 (A:118-248) automated matches {Thermococcus kodakarensis [TaxId: 311400]}
antpeieipslpwtvkavvlagalkravkaaklvsdsiyfmatpekltfkaegndsevrt
vltmedpglldlehkmtkaksaygvayledilrsladadeviirfgfdiplllkymvrda
gevsfliaprv

Timeline for d3lx2a2:

• d3lx2a2 first appeared in SCOPe 2.03
  
• d3lx2a2 appears in SCOPe 2.07