SCOP 1.73: Domain d1bfog2: 1bfo G:108-214

Lineage for d1bfog2 (1bfo G:108-214)

Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
Species Rat (Rattus norvegicus) [TaxId:10116] [88568] (5 PDB entries)

Domain d1bfog2: 1bfo G:108-214 [21308]
Other proteins in same PDB: d1bfoa1, d1bfob1, d1bfob2, d1bfoc1, d1bfod1, d1bfod2, d1bfoe1, d1bfof1, d1bfof2, d1bfog1, d1bfoh1, d1bfoh2
part of therapeutic monoclonal antibody CAMPATH-1G

Details for d1bfog2

PDB Entry: 1bfo (more details), 2.6 Å

PDB Description: campath-1g igg2b rat monoclonal fab

PDB Compounds: (G:) campath-1g antibody

SCOP Domain Sequences for d1bfog2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfog2 b.1.1.2 (G:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]}
ranaaptvsifppsteqlatggasvvclmnkfyprdisvkwkidgterngvlnsvtdqds
adstysmsstlsltkadyqshnlytcqvvhktssspvvaknfnrnec

SCOP Domain Coordinates for d1bfog2:

Click to download the PDB-style file with coordinates for d1bfog2.
(The format of our PDB-style files is described here.)

Timeline for d1bfog2: