Lineage for d3lwba2 (3lwb A:151-368)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217268Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2217269Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2217671Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2217672Protein automated matches [226904] (32 species)
    not a true protein
  7. 2217750Species Mycobacterium tuberculosis [TaxId:1773] [225852] (1 PDB entry)
  8. 2217751Domain d3lwba2: 3lwb A:151-368 [213078]
    Other proteins in same PDB: d3lwba1, d3lwbb1
    automated match to d1ehib2
    complexed with no3

Details for d3lwba2

PDB Entry: 3lwb (more details), 2.1 Å

PDB Description: crystal structure of apo d-alanine:d-alanine ligase (ddl) from mycobacterium tuberculosis
PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d3lwba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lwba2 d.142.1.0 (A:151-368) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dkeftkkllaadglpvgayavlrpprstlhrqecerlglpvfvkparggssigvsrvssw
dqlpaavararrhdpkviveaaisgrelecgvlempdgtleastlgeirvagvrgredsf
ydfatkylddaaeldvpakvddqvaeairqlairafaaidcrglarvdffltddgpvine
intmpgfttismyprmwaasgvdyptllatmiettlar

SCOPe Domain Coordinates for d3lwba2:

Click to download the PDB-style file with coordinates for d3lwba2.
(The format of our PDB-style files is described here.)

Timeline for d3lwba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lwba1