Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (18 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [225852] (1 PDB entry) |
Domain d3lwba2: 3lwb A:151-368 [213078] Other proteins in same PDB: d3lwba1, d3lwbb1 automated match to d1ehib2 complexed with no3 |
PDB Entry: 3lwb (more details), 2.1 Å
SCOPe Domain Sequences for d3lwba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lwba2 d.142.1.0 (A:151-368) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} dkeftkkllaadglpvgayavlrpprstlhrqecerlglpvfvkparggssigvsrvssw dqlpaavararrhdpkviveaaisgrelecgvlempdgtleastlgeirvagvrgredsf ydfatkylddaaeldvpakvddqvaeairqlairafaaidcrglarvdffltddgpvine intmpgfttismyprmwaasgvdyptllatmiettlar
Timeline for d3lwba2: