Lineage for d1bfof2 (1bfo F:122-216)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2026995Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 2027883Species Norway rat (Rattus norvegicus) [TaxId:10116] [88578] (5 PDB entries)
  8. 2027888Domain d1bfof2: 1bfo F:122-216 [21307]
    Other proteins in same PDB: d1bfoa1, d1bfoa2, d1bfob1, d1bfoc1, d1bfoc2, d1bfod1, d1bfoe1, d1bfoe2, d1bfof1, d1bfog1, d1bfog2, d1bfoh1
    part of therapeutic monoclonal antibody CAMPATH-1G

Details for d1bfof2

PDB Entry: 1bfo (more details), 2.6 Å

PDB Description: campath-1g igg2b rat monoclonal fab
PDB Compounds: (F:) campath-1g antibody

SCOPe Domain Sequences for d1bfof2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfof2 b.1.1.2 (F:122-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aqttapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsg
lytltssvtsstwpsqtvtcnvahpasstkvdkkv

SCOPe Domain Coordinates for d1bfof2:

Click to download the PDB-style file with coordinates for d1bfof2.
(The format of our PDB-style files is described here.)

Timeline for d1bfof2: