SCOP 1.65: Domain d1bfof2: 1bfo F:122-216

Lineage for d1bfof2 (1bfo F:122-216)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [88578] (4 PDB entries)

8. Domain d1bfof2: 1bfo F:122-216 [21307]
   Other proteins in same PDB: d1bfoa1, d1bfoa2, d1bfob1, d1bfoc1, d1bfoc2, d1bfod1, d1bfoe1, d1bfoe2, d1bfof1, d1bfog1, d1bfog2, d1bfoh1

Details for d1bfof2

PDB Entry: 1bfo, 2.6 Å

PDB Description: campath-1g igg2b rat monoclonal fab

SCOP Domain Sequences for d1bfof2:

Sequence; same for both SEQRES and ATOM records:

>d1bfof2 b.1.1.2 (F:122-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Rat (Rattus norvegicus)}
aqttapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsg
lytltssvtsstwpsqtvtcnvahpasstkvdkkv

Timeline for d1bfof2:

• d1bfof2 first appeared (with stable ids) in SCOP 1.55
  
• d1bfof2 appears in SCOP 1.63
  
• d1bfof2 appears in SCOP 1.67
  
• d1bfof2 appears in the current release, SCOPe 2.08