Lineage for d1bfoe2 (1bfo E:108-214)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 103836Species CAMPATH-1G igg2b monoclonal fab (rat), kappa L chain [49077] (1 PDB entry)
  8. 103841Domain d1bfoe2: 1bfo E:108-214 [21306]
    Other proteins in same PDB: d1bfoa1, d1bfob1, d1bfoc1, d1bfod1, d1bfoe1, d1bfof1, d1bfog1, d1bfoh1

Details for d1bfoe2

PDB Entry: 1bfo (more details), 2.6 Å

PDB Description: campath-1g igg2b rat monoclonal fab

SCOP Domain Sequences for d1bfoe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfoe2 b.1.1.2 (E:108-214) Immunoglobulin (constant domains of L and H chains) {CAMPATH-1G igg2b monoclonal fab (rat), kappa L chain}
ranaaptvsifppsteqlatggasvvclmnkfyprdisvkwkidgterngvlnsvtdqds
adstysmsstlsltkadyqshnlytcqvvhktssspvvaknfnrnec

SCOP Domain Coordinates for d1bfoe2:

Click to download the PDB-style file with coordinates for d1bfoe2.
(The format of our PDB-style files is described here.)

Timeline for d1bfoe2: