Lineage for d3ltev_ (3lte V:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1356043Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1356404Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1356405Protein automated matches [190131] (48 species)
    not a true protein
  7. 1356415Species Bermanella marisrubri [TaxId:207949] [225858] (1 PDB entry)
  8. 1356437Domain d3ltev_: 3lte V: [213040]
    automated match to d1nxoa_
    complexed with gol, po4

Details for d3ltev_

PDB Entry: 3lte (more details), 2 Å

PDB Description: crystal structure of response regulator (signal receiver domain) from bermanella marisrubri
PDB Compounds: (V:) Response regulator

SCOPe Domain Sequences for d3ltev_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ltev_ c.23.1.0 (V:) automated matches {Bermanella marisrubri [TaxId: 207949]}
skrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsmpkldg
ldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrihdlv

SCOPe Domain Coordinates for d3ltev_:

Click to download the PDB-style file with coordinates for d3ltev_.
(The format of our PDB-style files is described here.)

Timeline for d3ltev_: