Lineage for d1bfoc2 (1bfo C:108-214)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8591Species CAMPATH-1G igg2b monoclonal fab (rat), kappa L chain [49077] (1 PDB entry)
  8. 8594Domain d1bfoc2: 1bfo C:108-214 [21304]
    Other proteins in same PDB: d1bfoa1, d1bfob1, d1bfoc1, d1bfod1, d1bfoe1, d1bfof1, d1bfog1, d1bfoh1

Details for d1bfoc2

PDB Entry: 1bfo (more details), 2.6 Å

PDB Description: campath-1g igg2b rat monoclonal fab

SCOP Domain Sequences for d1bfoc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfoc2 b.1.1.2 (C:108-214) Immunoglobulin (constant domains of L and H chains) {CAMPATH-1G igg2b monoclonal fab (rat), kappa L chain}
ranaaptvsifppsteqlatggasvvclmnkfyprdisvkwkidgterngvlnsvtdqds
adstysmsstlsltkadyqshnlytcqvvhktssspvvaknfnrnec

SCOP Domain Coordinates for d1bfoc2:

Click to download the PDB-style file with coordinates for d1bfoc2.
(The format of our PDB-style files is described here.)

Timeline for d1bfoc2: