Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [88578] (5 PDB entries) |
Domain d1bfob2: 1bfo B:122-216 [21303] Other proteins in same PDB: d1bfoa1, d1bfoa2, d1bfob1, d1bfoc1, d1bfoc2, d1bfod1, d1bfoe1, d1bfoe2, d1bfof1, d1bfog1, d1bfog2, d1bfoh1 part of therapeutic monoclonal antibody CAMPATH-1G |
PDB Entry: 1bfo (more details), 2.6 Å
SCOP Domain Sequences for d1bfob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bfob2 b.1.1.2 (B:122-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Rat (Rattus norvegicus) [TaxId: 10116]} aqttapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsg lytltssvtsstwpsqtvtcnvahpasstkvdkkv
Timeline for d1bfob2: