Lineage for d3ltef1 (3lte F:64-185)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2855861Species Bermanella marisrubri [TaxId:207949] [225858] (1 PDB entry)
  8. 2855867Domain d3ltef1: 3lte F:64-185 [213024]
    Other proteins in same PDB: d3lted2, d3ltee2, d3ltef2, d3lteg2, d3lteh2, d3ltei2, d3ltep2
    automated match to d1nxoa_
    complexed with gol, po4

Details for d3ltef1

PDB Entry: 3lte (more details), 2 Å

PDB Description: crystal structure of response regulator (signal receiver domain) from bermanella marisrubri
PDB Compounds: (F:) Response regulator

SCOPe Domain Sequences for d3ltef1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ltef1 c.23.1.0 (F:64-185) automated matches {Bermanella marisrubri [TaxId: 207949]}
lkqskrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsmpk
ldgldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrihdl
vn

SCOPe Domain Coordinates for d3ltef1:

Click to download the PDB-style file with coordinates for d3ltef1.
(The format of our PDB-style files is described here.)

Timeline for d3ltef1: