Class a: All alpha proteins [46456] (285 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
Protein automated matches [226859] (26 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226080] (2 PDB entries) |
Domain d3lsud1: 3lsu D:1-90 [213017] Other proteins in same PDB: d3lsua2, d3lsub2, d3lsuc2, d3lsud2 automated match to d1kkca1 complexed with gol, mn, na |
PDB Entry: 3lsu (more details), 1.9 Å
SCOPe Domain Sequences for d3lsud1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lsud1 a.2.11.0 (D:1-90) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kvtlpdlkwdfgalepyisgqinelhytkhhqtyvngfntavdqfqelsdllakepspan arkmiaiqqnikfhgggftnhclfwenlap
Timeline for d3lsud1: