SCOPe 2.08: Domain d3lrta2: 3lrt A:156-284

Lineage for d3lrta2 (3lrt A:156-284)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (38 species)
   not a true protein

7. Species Thermoplasma volcanium [TaxId:50339] [226070] (3 PDB entries)

8. Domain d3lrta2: 3lrt A:156-284 [213000]
   automated match to d1dkra2
   complexed with adp, so4

Details for d3lrta2

PDB Entry: 3lrt, 1.53 Å

PDB Description: Crystal structure of the phosphoribosyl pyrophosphate (PRPP) synthetase from Thermoplasma volcanium in complex with ADP.

PDB Compounds: (A:) Ribose-phosphate pyrophosphokinase

SCOPe Domain Sequences for d3lrta2:

Sequence; same for both SEQRES and ATOM records:

>d3lrta2 c.61.1.0 (A:156-284) automated matches {Thermoplasma volcanium [TaxId: 50339]}
yvvspddgglarvadisaklgkkhffiekkriddrtvemkvpnvdvngkkllivddiist
ggtiakssgllrekgaskiyvsavhglfvngsenkilqnadeihvtdtveskfsdisvyq
evcnyirdi

Timeline for d3lrta2:

• d3lrta2 first appeared in SCOPe 2.03
  
• d3lrta2 appears in SCOPe 2.07