Lineage for d3lrsb2 (3lrs B:108-209)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750767Domain d3lrsb2: 3lrs B:108-209 [212992]
    Other proteins in same PDB: d3lrsa_, d3lrsb1, d3lrsc_, d3lrsd1, d3lrse_, d3lrsf1, d3lrsh_, d3lrsl1
    automated match to d1jvka2
    complexed with nag

Details for d3lrsb2

PDB Entry: 3lrs (more details), 2.37 Å

PDB Description: structure of pg16, an antibody with broad and potent neutralization of hiv-1
PDB Compounds: (B:) PG-16 Light Chain Fab

SCOPe Domain Sequences for d3lrsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lrsb2 b.1.1.2 (B:108-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvapt

SCOPe Domain Coordinates for d3lrsb2:

Click to download the PDB-style file with coordinates for d3lrsb2.
(The format of our PDB-style files is described here.)

Timeline for d3lrsb2: