Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [88575] (63 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
Domain d1b2wh2: 1b2w H:118-220 [21299] Other proteins in same PDB: d1b2wh1, d1b2wl1, d1b2wl2 part of a humanized anti-gamma-interferon Fab |
PDB Entry: 1b2w (more details), 2.9 Å
SCOP Domain Sequences for d1b2wh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b2wh2 b.1.1.2 (H:118-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)} astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
Timeline for d1b2wh2: