Lineage for d1b2wh2 (1b2w H:118-220)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 54037Species Humanized and chimeric anti-gamma-interferon Fab [49076] (2 PDB entries)
  8. 54038Domain d1b2wh2: 1b2w H:118-220 [21299]
    Other proteins in same PDB: d1b2wh1, d1b2wl1

Details for d1b2wh2

PDB Entry: 1b2w (more details), 2.9 Å

PDB Description: comparison of the three-dimensional structures of a humanized and a chimeric fab of an anti-gamma-interferon antibody

SCOP Domain Sequences for d1b2wh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b2wh2 b.1.1.2 (H:118-220) Immunoglobulin (constant domains of L and H chains) {Humanized and chimeric anti-gamma-interferon Fab}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOP Domain Coordinates for d1b2wh2:

Click to download the PDB-style file with coordinates for d1b2wh2.
(The format of our PDB-style files is described here.)

Timeline for d1b2wh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b2wh1