Lineage for d3lnua1 (3lnu A:59-260)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1667394Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1667395Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1667910Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 1667911Protein automated matches [226867] (11 species)
    not a true protein
  7. 1668002Species Xanthomonas oryzae [TaxId:291331] [226075] (2 PDB entries)
  8. 1668003Domain d3lnua1: 3lnu A:59-260 [212976]
    Other proteins in same PDB: d3lnua2
    automated match to d1s16a2

Details for d3lnua1

PDB Entry: 3lnu (more details), 2.2 Å

PDB Description: Crystal structure of ParE subunit
PDB Compounds: (A:) Topoisomerase IV subunit B

SCOPe Domain Sequences for d3lnua1:

Sequence, based on SEQRES records: (download)

>d3lnua1 d.122.1.0 (A:59-260) automated matches {Xanthomonas oryzae [TaxId: 291331]}
gldpvkrrpgmytdtarpnhlaqevidnsvdealaghakqievtlykdgscevsddgrgm
pvdihpeekipgveliltrlhaggkfnnrnytfsgglhgvgvsvvnalstkvelfikreg
sehrmefrdgnaasklevvgtvgkkntgtrlrfwadpkyfdtpkfnvralrhllrakavl
cpgltvklhdeatgeqdswyfe

Sequence, based on observed residues (ATOM records): (download)

>d3lnua1 d.122.1.0 (A:59-260) automated matches {Xanthomonas oryzae [TaxId: 291331]}
gldpvkrrpgmytdtarpnhlaqevidnsvdealaghakqievtlykdgscevsddgrgm
pvdihpeekipgveliltrlgvsvvnalstkvelfikregsehrmefrdgnaasklevvg
tvgkkntgtrlrfwadpkyfdtpkfnvralrhllrakavlcpgltvklhdeatgeqdswy
fe

SCOPe Domain Coordinates for d3lnua1:

Click to download the PDB-style file with coordinates for d3lnua1.
(The format of our PDB-style files is described here.)

Timeline for d3lnua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lnua2