SCOP 1.59: Domain d1axtl2: 1axt L:108-211

Lineage for d1axtl2 (1axt L:108-211)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)

7. Species Catalytic Fab 33F12 (mouse), kappa L chain [49075] (1 PDB entry)

8. Domain d1axtl2: 1axt L:108-211 [21296]
   Other proteins in same PDB: d1axth1, d1axtl1

Details for d1axtl2

PDB Entry: 1axt, 2.15 Å

PDB Description: immune versus natural selection: antibody aldolases with the rates of natural enzymes

SCOP Domain Sequences for d1axtl2:

Sequence; same for both SEQRES and ATOM records:

>d1axtl2 b.1.1.2 (L:108-211) Immunoglobulin (constant domains of L and H chains) {Catalytic Fab 33F12 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d1axtl2:

• d1axtl2 first appeared (with stable ids) in SCOP 1.55
  
• d1axtl2 appears in SCOP 1.57
  
• d1axtl2 appears in SCOP 1.61
  
• d1axtl2 appears in the current release, SCOPe 2.08