Lineage for d1axtl2 (1axt L:108-211)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8603Species Catalytic Fab 33F12 (mouse), kappa L chain [49075] (1 PDB entry)
  8. 8605Domain d1axtl2: 1axt L:108-211 [21296]
    Other proteins in same PDB: d1axth1, d1axtl1

Details for d1axtl2

PDB Entry: 1axt (more details), 2.15 Å

PDB Description: immune versus natural selection: antibody aldolases with the rates of natural enzymes

SCOP Domain Sequences for d1axtl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axtl2 b.1.1.2 (L:108-211) Immunoglobulin (constant domains of L and H chains) {Catalytic Fab 33F12 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d1axtl2:

Click to download the PDB-style file with coordinates for d1axtl2.
(The format of our PDB-style files is described here.)

Timeline for d1axtl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1axtl1