Lineage for d1a5fh2 (1a5f H:121-217)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8489Species Anti-E-selectin Fab (mouse), kappa L chain [49074] (1 PDB entry)
  8. 8490Domain d1a5fh2: 1a5f H:121-217 [21295]
    Other proteins in same PDB: d1a5fh1, d1a5fl1

Details for d1a5fh2

PDB Entry: 1a5f (more details), 2.8 Å

PDB Description: fab fragment of a monoclonal anti-e-selectin antibody

SCOP Domain Sequences for d1a5fh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5fh2 b.1.1.2 (H:121-217) Immunoglobulin (constant domains of L and H chains) {Anti-E-selectin Fab (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvsvptstetvtcnvahapsstkvdkkivpr

SCOP Domain Coordinates for d1a5fh2:

Click to download the PDB-style file with coordinates for d1a5fh2.
(The format of our PDB-style files is described here.)

Timeline for d1a5fh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a5fh1