SCOPe 2.03: Domain d3lmya1: 3lmy A:54-199

Lineage for d3lmya1 (3lmy A:54-199)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.0: automated matches [227269] (1 protein)
   not a true family

6. Protein automated matches [227062] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226074] (1 PDB entry)

8. Domain d3lmya1: 3lmy A:54-199 [212944]
   Other proteins in same PDB: d3lmya2, d3lmyb2
   automated match to d2gjxa2
   complexed with cp6, nag, ndg, so4

Details for d3lmya1

PDB Entry: 3lmy, 2.8 Å

PDB Description: the crystal structure of beta-hexosaminidase b in complex with pyrimethamine

PDB Compounds: (A:) Beta-hexosaminidase subunit beta

SCOPe Domain Sequences for d3lmya1:

Sequence, based on SEQRES records:

>d3lmya1 d.92.2.0 (A:54-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgfykwhh
epaefqaktqvqqllvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgle
tfsqlvyqdsygtftinestiidspr

Sequence, based on observed residues (ATOM records):

>d3lmya1 d.92.2.0 (A:54-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyiftqvqqll
vsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygtft
inestiidspr

Timeline for d3lmya1:

• d3lmya1 is new in SCOPe 2.03-stable
  
• d3lmya1 appears in SCOPe 2.04
  
• d3lmya1 appears in the current release, SCOPe 2.08