Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species) |
Species Anti-E-selectin Fab (mouse), kappa L chain [49074] (1 PDB entry) |
Domain d1a5fl2: 1a5f L:114-220 [21294] Other proteins in same PDB: d1a5fh1, d1a5fl1 |
PDB Entry: 1a5f (more details), 2.8 Å
SCOP Domain Sequences for d1a5fl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a5fl2 b.1.1.2 (L:114-220) Immunoglobulin (constant domains of L and H chains) {Anti-E-selectin Fab (mouse), kappa L chain} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1a5fl2: