Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) duplication contains two domains of this fold |
Family c.55.1.10: ROK [110636] (8 proteins) Pfam PF00480 |
Protein Putative fructokinase YhdR [117642] (1 species) |
Species Bacillus subtilis [TaxId:1423] [117643] (3 PDB entries) Uniprot O05510 |
Domain d3lm9a2: 3lm9 A:119-293 [212935] automated match to d1xc3a2 complexed with adp, fru, so4, zn |
PDB Entry: 3lm9 (more details), 2.45 Å
SCOPe Domain Sequences for d3lm9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lm9a2 c.55.1.10 (A:119-293) Putative fructokinase YhdR {Bacillus subtilis [TaxId: 1423]} gldsclyitigtgigagaivegrllqglshpemghiyirrhpddvyqgkcpyhgdcfegl asgpaiearwgkkaadlsdiaqvwelegyyiaqalaqyililapkkiilgggvmqqkqvf syiyqyvpkimnsyldfselsddisdyivpprlgsnagiigtlvlahqalqaeaa
Timeline for d3lm9a2: