Lineage for d3ljfd2 (3ljf D:83-192)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946299Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2946300Protein automated matches [226860] (38 species)
    not a true protein
  7. 2946496Species Pseudoalteromonas haloplanktis [TaxId:326442] [225960] (4 PDB entries)
  8. 2946506Domain d3ljfd2: 3ljf D:83-192 [212924]
    Other proteins in same PDB: d3ljfa1, d3ljfb1, d3ljfc1, d3ljfd1
    automated match to d2nyba2
    complexed with fe

Details for d3ljfd2

PDB Entry: 3ljf (more details), 2.1 Å

PDB Description: the x-ray structure of iron superoxide dismutase from pseudoalteromonas haloplanktis (crystal form ii)
PDB Compounds: (D:) iron superoxide dismutase

SCOPe Domain Sequences for d3ljfd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ljfd2 d.44.1.0 (D:83-192) automated matches {Pseudoalteromonas haloplanktis [TaxId: 326442]}
ngggaptgavadainakwgsfdafkealndkavnnfgsswtwlvkladgsldivntsnaa
tpltddgvtpiltvdlwehayyidyrnvrpdylkgfwslvnwefananfa

SCOPe Domain Coordinates for d3ljfd2:

Click to download the PDB-style file with coordinates for d3ljfd2.
(The format of our PDB-style files is described here.)

Timeline for d3ljfd2: