SCOPe 2.08: Domain d3ljfd1: 3ljf D:1-82

Lineage for d3ljfd1 (3ljf D:1-82)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (39 species)
   not a true protein

7. Species Pseudoalteromonas haloplanktis [TaxId:326442] [225959] (4 PDB entries)

8. Domain d3ljfd1: 3ljf D:1-82 [212923]
   Other proteins in same PDB: d3ljfa2, d3ljfb2, d3ljfc2, d3ljfd2
   automated match to d1isca1
   complexed with fe

Details for d3ljfd1

PDB Entry: 3ljf, 2.1 Å

PDB Description: the x-ray structure of iron superoxide dismutase from pseudoalteromonas haloplanktis (crystal form ii)

PDB Compounds: (D:) iron superoxide dismutase

SCOPe Domain Sequences for d3ljfd1:

Sequence; same for both SEQRES and ATOM records:

>d3ljfd1 a.2.11.0 (D:1-82) automated matches {Pseudoalteromonas haloplanktis [TaxId: 326442]}
afelpslpyaidalephisketlefhhgkhhntyvvklnglipgtkfenksleeivcssd
ggvfnnaaqiwnhtfywnslsp

Timeline for d3ljfd1:

• d3ljfd1 first appeared in SCOPe 2.03
  
• d3ljfd1 appears in SCOPe 2.07