Lineage for d15c8l2 (15c8 L:108-212)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 786045Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)
  7. 786271Species Mouse (Mus musculus) [TaxId:10090] [88567] (318 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity
    SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region)
    Uniprot P01837 # KAC_MOUSE Ig kappa chain C region
    Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region
    SQ NA # part of Fab 28 against HIV-1 RT
    Uniprot P01837 #
    KAC_MOUSE Ig kappa chain C region
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 786490Domain d15c8l2: 15c8 L:108-212 [21292]
    Other proteins in same PDB: d15c8h1, d15c8h2, d15c8l1
    part of catalytic Fab 5C8

Details for d15c8l2

PDB Entry: 15c8 (more details), 2.5 Å

PDB Description: catalytic antibody 5c8, free fab
PDB Compounds: (L:) igg 5c8 fab (light chain)

SCOP Domain Sequences for d15c8l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d15c8l2 b.1.1.2 (L:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOP Domain Coordinates for d15c8l2:

Click to download the PDB-style file with coordinates for d15c8l2.
(The format of our PDB-style files is described here.)

Timeline for d15c8l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d15c8l1