SCOP 1.67: Domain d15c8l2: 15c8 L:108-212

Lineage for d15c8l2 (15c8 L:108-212)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)

8. Domain d15c8l2: 15c8 L:108-212 [21292]
   Other proteins in same PDB: d15c8h1, d15c8h2, d15c8l1
   part of catalytic Fab 5C8

Details for d15c8l2

PDB Entry: 15c8, 2.5 Å

PDB Description: catalytic antibody 5c8, free fab

SCOP Domain Sequences for d15c8l2:

Sequence; same for both SEQRES and ATOM records:

>d15c8l2 b.1.1.2 (L:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d15c8l2:

• d15c8l2 first appeared (with stable ids) in SCOP 1.55
  
• d15c8l2 appears in SCOP 1.65
  
• d15c8l2 appears in SCOP 1.69
  
• d15c8l2 appears in the current release, SCOPe 2.08