SCOPe 2.05: Domain d3lj9a1: 3lj9 A:1-82

Lineage for d3lj9a1 (3lj9 A:1-82)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (31 species)
   not a true protein

7. Species Pseudoalteromonas haloplanktis [TaxId:326442] [225959] (4 PDB entries)

8. Domain d3lj9a1: 3lj9 A:1-82 [212913]
   Other proteins in same PDB: d3lj9a2, d3lj9b2
   automated match to d1isca1
   complexed with azi, fe, tre

Details for d3lj9a1

PDB Entry: 3lj9, 2.1 Å

PDB Description: x-ray structure of the iron superoxide dismutase from pseudoalteromonas haloplanktis in complex with sodium azide

PDB Compounds: (A:) iron superoxide dismutase

SCOPe Domain Sequences for d3lj9a1:

Sequence; same for both SEQRES and ATOM records:

>d3lj9a1 a.2.11.0 (A:1-82) automated matches {Pseudoalteromonas haloplanktis [TaxId: 326442]}
afelpslpyaidalephisketlefhhgkhhntyvvklnglipgtkfenksleeivcssd
ggvfnnaaqiwnhtfywnslsp

Timeline for d3lj9a1:

• d3lj9a1 first appeared in SCOPe 2.03
  
• d3lj9a1 appears in SCOPe 2.04
  
• d3lj9a1 appears in SCOPe 2.06
  
• d3lj9a1 appears in the current release, SCOPe 2.08