Lineage for d25c8h2 (25c8 H:114-226)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8611Species Catalytic Fab 5C8 (mouse), kappa L chain [49073] (3 PDB entries)
  8. 8614Domain d25c8h2: 25c8 H:114-226 [21291]
    Other proteins in same PDB: d25c8h1, d25c8l1

Details for d25c8h2

PDB Entry: 25c8 (more details), 2 Å

PDB Description: catalytic antibody 5c8, fab-hapten complex

SCOP Domain Sequences for d25c8h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d25c8h2 b.1.1.2 (H:114-226) Immunoglobulin (constant domains of L and H chains) {Catalytic Fab 5C8 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkiv

SCOP Domain Coordinates for d25c8h2:

Click to download the PDB-style file with coordinates for d25c8h2.
(The format of our PDB-style files is described here.)

Timeline for d25c8h2:

View in 3D
Domains from same chain:
(mouse over for more information)
d25c8h1