SCOPe 2.03: Domain d3li2b_: 3li2 B:

Lineage for d3li2b_ (3li2 B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.0: automated matches [191548] (1 protein)
   not a true family

6. Protein automated matches [190944] (18 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:426430] [225834] (2 PDB entries)

8. Domain d3li2b_: 3li2 B: [212896]
   automated match to d3tefa_
   complexed with act, fe, sf8, zn

Details for d3li2b_

PDB Entry: 3li2, 2.2 Å

PDB Description: Closed Conformation of HtsA Complexed with Staphyloferrin A

PDB Compounds: (B:) Ferrichrome ABC transporter lipoprotein

SCOPe Domain Sequences for d3li2b_:

Sequence; same for both SEQRES and ATOM records:

>d3li2b_ c.92.2.0 (B:) automated matches {Staphylococcus aureus [TaxId: 426430]}
astisvkdengtvkvpkdakrivvleysfadalaaldvkpvgiaddgkkkriikpvreki
gdytsvgtrkqpnleeisklkpdliiadssrhkginkelnkiaptlslksfdgdykqnin
sfktiakalnkekegekrlaehdklinkykdeikfdrnqkvlpavvakagllahpnysyv
gqflnelgfknalsddvtkglskylkgpylqldtehladlnpermiimtdhakkdsaefk
klqedatwkklnavknnrvdivdrdvwarsrglisseemakelvelskk

Timeline for d3li2b_:

• d3li2b_ is new in SCOPe 2.03-stable
  
• d3li2b_ appears in SCOPe 2.04
  
• d3li2b_ appears in the current release, SCOPe 2.08, called d3li2b1