SCOP 1.59: Domain d35c8h2: 35c8 H:114-226

Lineage for d35c8h2 (35c8 H:114-226)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)

7. Species Catalytic Fab 5C8 (mouse), kappa L chain [49073] (3 PDB entries)

8. Domain d35c8h2: 35c8 H:114-226 [21289]
   Other proteins in same PDB: d35c8h1, d35c8l1

Details for d35c8h2

PDB Entry: 35c8, 2 Å

PDB Description: catalytic antibody 5c8, fab-inhibitor complex

SCOP Domain Sequences for d35c8h2:

Sequence; same for both SEQRES and ATOM records:

>d35c8h2 b.1.1.2 (H:114-226) Immunoglobulin (constant domains of L and H chains) {Catalytic Fab 5C8 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkiv

Timeline for d35c8h2:

• d35c8h2 first appeared (with stable ids) in SCOP 1.55
  
• d35c8h2 appears in SCOP 1.57
  
• d35c8h2 appears in SCOP 1.61
  
• d35c8h2 appears in the current release, SCOPe 2.08