Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (42 species) not a true protein |
Species Pyrococcus abyssi [TaxId:272844] [225897] (2 PDB entries) |
Domain d3lhdd_: 3lhd D: [212888] automated match to d2yvla_ protein/RNA complex; complexed with sah |
PDB Entry: 3lhd (more details), 2.59 Å
SCOPe Domain Sequences for d3lhdd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lhdd_ c.66.1.0 (D:) automated matches {Pyrococcus abyssi [TaxId: 272844]} miregdkvvlvdprgkrylitvskrdfhtdlgilkleeiigrnfgeaikshkghefkilr privdyldkmkrgpqivhpkdaalivayagispgdfiveagvgsgaltlflanivgpegr vvsyeiredfaklawenikwagfddrvtiklkdiyegieeenvdhvildlpqpervveha akalkpggffvaytpcsnqvmrlheklrefkdyfmkprtinvlvfdqevkkecmrprtta lvhtgyitfarri
Timeline for d3lhdd_: