Lineage for d3lhdc_ (3lhd C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1611695Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1611696Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1612879Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 1612880Protein automated matches [190689] (47 species)
    not a true protein
  7. 1613091Species Pyrococcus abyssi [TaxId:272844] [225897] (2 PDB entries)
  8. 1613098Domain d3lhdc_: 3lhd C: [212887]
    automated match to d2yvla_
    protein/RNA complex; complexed with sah

Details for d3lhdc_

PDB Entry: 3lhd (more details), 2.59 Å

PDB Description: Crystal structure of P. abyssi tRNA m1A58 methyltransferase in complex with S-adenosyl-L-homocysteine
PDB Compounds: (C:) SAM-dependent methyltransferase, putative

SCOPe Domain Sequences for d3lhdc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lhdc_ c.66.1.0 (C:) automated matches {Pyrococcus abyssi [TaxId: 272844]}
miregdkvvlvdprgkrylitvskrdfhtdlgilkleeiigrnfgeaikshkghefkilr
privdyldkmkrgpqivhpkdaalivayagispgdfiveagvgsgaltlflanivgpegr
vvsyeiredfaklawenikwagfddrvtiklkdiyegieeenvdhvildlpqpervveha
akalkpggffvaytpcsnqvmrlheklrefkdyfmkprtinvlvfdqevkkecmrprtta
lvhtgyitfarri

SCOPe Domain Coordinates for d3lhdc_:

Click to download the PDB-style file with coordinates for d3lhdc_.
(The format of our PDB-style files is described here.)

Timeline for d3lhdc_: