SCOPe 2.06: Domain d3lh2k1: 3lh2 K:2-126

Lineage for d3lh2k1 (3lh2 K:2-126)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d3lh2k1: 3lh2 K:2-126 [212880]
   Other proteins in same PDB: d3lh2h2, d3lh2i2, d3lh2k2
   automated match to d3ebaa_

Details for d3lh2k1

PDB Entry: 3lh2, 2.65 Å

PDB Description: Crystal structure of HIV epitope-scaffold 4E10_1VI7A_S0_002_N 4E10 Fv complex

PDB Compounds: (K:) Fv 4E10 heavy chain

SCOPe Domain Sequences for d3lh2k1:

Sequence; same for both SEQRES and ATOM records:

>d3lh2k1 b.1.1.0 (K:2-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitnya
prfqgrititadrststaylelnslrpedtavyycaregttgagwlgkpigafahwgqgt
lvtvs

Timeline for d3lh2k1:

• d3lh2k1 first appeared in SCOPe 2.03, called d3lh2k_
  
• d3lh2k1 was called d3lh2k_ in SCOPe 2.05
  
• d3lh2k1 appears in SCOPe 2.07
  
• d3lh2k1 appears in the current release, SCOPe 2.08