Lineage for d3leha2 (3leh A:168-388)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2164457Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2164458Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2165221Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2165222Protein automated matches [196909] (60 species)
    not a true protein
  7. 2165943Species Streptococcus mutans [TaxId:210007] [226059] (1 PDB entry)
  8. 2165945Domain d3leha2: 3leh A:168-388 [212857]
    automated match to d1xpma2
    complexed with no3

Details for d3leha2

PDB Entry: 3leh (more details), 1.7 Å

PDB Description: The Crystal Structure of smu.943c from Streptococcus mutans UA159
PDB Compounds: (A:) Putative hydroxymethylglutaryl-CoA synthase

SCOPe Domain Sequences for d3leha2:

Sequence, based on SEQRES records: (download)

>d3leha2 c.95.1.0 (A:168-388) automated matches {Streptococcus mutans [TaxId: 210007]}
ililhdetlaqtrdimdfwrpnytttpyvngmystkqyldmlkttwaeyqkrfdvsltdf
aafcfhlpfpklalkgfnkimdkqvpsdlqeklkvnfeasilyskqigniytgslflgll
sllensqnlvagdkialfsygsgavaeiftgtlvkgfkeqlqtnrldklkrrtplsveny
ekiffeeaqlddkgnasfkeyqtgpfalkeilehqriygkv

Sequence, based on observed residues (ATOM records): (download)

>d3leha2 c.95.1.0 (A:168-388) automated matches {Streptococcus mutans [TaxId: 210007]}
ililhdetlaqtrdistkqyldmlkttwaeyqkrfdvsltdfaafcfhlpfpklalkgfn
kidkqpsdlqeklkvnfeasilyskqigniytgslflgllsllensqnlvagdkialfsy
gsgavaeiftgtlvkgfkeqlqtnrldklkrrtplsvenyekiffeeaqasfkeyqtgpf
alkeilehqriygkv

SCOPe Domain Coordinates for d3leha2:

Click to download the PDB-style file with coordinates for d3leha2.
(The format of our PDB-style files is described here.)

Timeline for d3leha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3leha1