Lineage for d3ldpa2 (3ldp A:215-406)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885061Species Human (Homo sapiens) [TaxId:9606] [224896] (72 PDB entries)
  8. 2885131Domain d3ldpa2: 3ldp A:215-406 [212851]
    automated match to d1ngfa2
    complexed with 3p1

Details for d3ldpa2

PDB Entry: 3ldp (more details), 2.2 Å

PDB Description: Crystal structure of human GRP78 (70kDa heat shock protein 5 / BIP) ATPase domain in complex with small molecule inhibitor
PDB Compounds: (A:) 78 kDa glucose-regulated protein

SCOPe Domain Sequences for d3ldpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ldpa2 c.55.1.0 (A:215-406) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmehfiklykkkt
gkdvrkdnravqklrrevekakralssqhqarieiesfyegedfsetltrakfeelnmdl
frstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkepsrginpdeav
aygaavqagvls

SCOPe Domain Coordinates for d3ldpa2:

Click to download the PDB-style file with coordinates for d3ldpa2.
(The format of our PDB-style files is described here.)

Timeline for d3ldpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ldpa1