Lineage for d1qfuh2 (1qfu H:114-214)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104480Species Influenza virus hemagglutinin-neutralizing Fab (mouse), kappa L chain [49071] (1 PDB entry)
  8. 104481Domain d1qfuh2: 1qfu H:114-214 [21285]
    Other proteins in same PDB: d1qfua_, d1qfub_, d1qfuh1, d1qful1

Details for d1qfuh2

PDB Entry: 1qfu (more details), 2.8 Å

PDB Description: influenza virus hemagglutinin complexed with a neutralizing antibody

SCOP Domain Sequences for d1qfuh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfuh2 b.1.1.2 (H:114-214) Immunoglobulin (constant domains of L and H chains) {Influenza virus hemagglutinin-neutralizing Fab (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd

SCOP Domain Coordinates for d1qfuh2:

Click to download the PDB-style file with coordinates for d1qfuh2.
(The format of our PDB-style files is described here.)

Timeline for d1qfuh2: