Lineage for d1oakh2 (1oak H:337-437)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289100Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 289192Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries)
  8. 289273Domain d1oakh2: 1oak H:337-437 [21283]
    Other proteins in same PDB: d1oaka_, d1oakh1, d1oakl1, d1oakl2
    part of Fab NMC-4 blocking the von willebrand factor (vwf) a1 domain function

Details for d1oakh2

PDB Entry: 1oak (more details), 2.2 Å

PDB Description: crystal structure of the von willebrand factor (vwf) a1 domain in complex with the function blocking nmc-4 fab

SCOP Domain Sequences for d1oakh2:

Sequence, based on SEQRES records: (download)

>d1oakh2 b.1.1.2 (H:337-437) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd

Sequence, based on observed residues (ATOM records): (download)

>d1oakh2 b.1.1.2 (H:337-437) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
ssvtvpsstwpsetvtcnvahpasstkvdkkivprd

SCOP Domain Coordinates for d1oakh2:

Click to download the PDB-style file with coordinates for d1oakh2.
(The format of our PDB-style files is described here.)

Timeline for d1oakh2: