Lineage for d1oakh2 (1oak H:337-437)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221644Species Fab NMC-4 (mouse), kappa L chain [49070] (2 PDB entries)
    the von willebrand factor (vwf) a1 domain function blocking
  8. 221647Domain d1oakh2: 1oak H:337-437 [21283]
    Other proteins in same PDB: d1oaka_, d1oakh1, d1oakl1

Details for d1oakh2

PDB Entry: 1oak (more details), 2.2 Å

PDB Description: crystal structure of the von willebrand factor (vwf) a1 domain in complex with the function blocking nmc-4 fab

SCOP Domain Sequences for d1oakh2:

Sequence, based on SEQRES records: (download)

>d1oakh2 b.1.1.2 (H:337-437) Immunoglobulin (constant domains of L and H chains) {Fab NMC-4 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd

Sequence, based on observed residues (ATOM records): (download)

>d1oakh2 b.1.1.2 (H:337-437) Immunoglobulin (constant domains of L and H chains) {Fab NMC-4 (mouse), kappa L chain}
akttppsvyplapgnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
ssvtvpsstwpsetvtcnvahpasstkvdkkivprd

SCOP Domain Coordinates for d1oakh2:

Click to download the PDB-style file with coordinates for d1oakh2.
(The format of our PDB-style files is described here.)

Timeline for d1oakh2: