SCOP 1.55: Domain d1fnsl2: 1fns L:108-214

Lineage for d1fnsl2 (1fns L:108-214)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab NMC-4 (mouse), kappa L chain [49070] (2 PDB entries)

8. Domain d1fnsl2: 1fns L:108-214 [21280]
   Other proteins in same PDB: d1fnsa_, d1fnsh1, d1fnsl1

Details for d1fnsl2

PDB Entry: 1fns, 2 Å

PDB Description: crystal structure of the von willebrand factor (vwf) a1 domain i546v mutant in complex with the function blocking fab nmc4

SCOP Domain Sequences for d1fnsl2:

Sequence; same for both SEQRES and ATOM records:

>d1fnsl2 b.1.1.2 (L:108-214) Immunoglobulin (constant domains of L and H chains) {Fab NMC-4 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1fnsl2:

• d1fnsl2 appears in SCOP 1.57
  
• d1fnsl2 appears in the current release, SCOPe 2.08