Lineage for d1a0qh2 (1a0q H:115-211)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655511Domain d1a0qh2: 1a0q H:115-211 [21279]
    Other proteins in same PDB: d1a0qh1, d1a0ql1, d1a0ql2
    part of catalytic antibody 29G11 with esterase activity
    complexed with hep, zn

Details for d1a0qh2

PDB Entry: 1a0q (more details), 2.3 Å

PDB Description: 29g11 complexed with phenyl [1-(1-n-succinylamino)pentyl] phosphonate
PDB Compounds: (H:) 29g11 fab (heavy chain)

SCOP Domain Sequences for d1a0qh2:

Sequence, based on SEQRES records: (download)

>d1a0qh2 b.1.1.2 (H:115-211) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
ytlsssvtvpsstwpsetvtcnvahpasstkvdkkie

Sequence, based on observed residues (ATOM records): (download)

>d1a0qh2 b.1.1.2 (H:115-211) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
kttppsvyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssv
tvpsstwpsetvtcnvahpasstkvdkkie

SCOP Domain Coordinates for d1a0qh2:

Click to download the PDB-style file with coordinates for d1a0qh2.
(The format of our PDB-style files is described here.)

Timeline for d1a0qh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a0qh1