SCOP 1.65: Domain d1a0ql2: 1a0q L:109-213

Lineage for d1a0ql2 (1a0q L:109-213)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries)

8. Domain d1a0ql2: 1a0q L:109-213 [21278]
   Other proteins in same PDB: d1a0qh1, d1a0qh2, d1a0ql1
   part of catalytic antibody 29G11 with esterase activity
   complexed with hep, zn

Details for d1a0ql2

PDB Entry: 1a0q, 2.3 Å

PDB Description: 29g11 complexed with phenyl [1-(1-n-succinylamino)pentyl] phosphonate

SCOP Domain Sequences for d1a0ql2:

Sequence; same for both SEQRES and ATOM records:

>d1a0ql2 b.1.1.2 (L:109-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
adaaptvsifppsseqltsggasvvcflnnfyskdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d1a0ql2:

• d1a0ql2 first appeared (with stable ids) in SCOP 1.55
  
• d1a0ql2 appears in SCOP 1.63
  
• d1a0ql2 appears in SCOP 1.67
  
• d1a0ql2 appears in the current release, SCOPe 2.08