SCOP 1.55: Domain d1a0ql2: 1a0q L:109-213

Lineage for d1a0ql2 (1a0q L:109-213)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab 29G11 (mouse), kappa L chain [49069] (1 PDB entry)

8. Domain d1a0ql2: 1a0q L:109-213 [21278]
   Other proteins in same PDB: d1a0qh1, d1a0ql1

Details for d1a0ql2

PDB Entry: 1a0q, 2.3 Å

PDB Description: 29g11 complexed with phenyl [1-(1-n-succinylamino)pentyl] phosphonate

SCOP Domain Sequences for d1a0ql2:

Sequence; same for both SEQRES and ATOM records:

>d1a0ql2 b.1.1.2 (L:109-213) Immunoglobulin (constant domains of L and H chains) {Fab 29G11 (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfyskdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d1a0ql2:

• d1a0ql2 appears in SCOP 1.57
  
• d1a0ql2 appears in the current release, SCOPe 2.08