Lineage for d1c9rl2 (1c9r L:108-214)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53514Species Fab 28 against HIV-1 RT (mouse), kappa L chain [49068] (3 PDB entries)
  8. 53520Domain d1c9rl2: 1c9r L:108-214 [21276]
    Other proteins in same PDB: d1c9ra1, d1c9ra2, d1c9rb1, d1c9rh1, d1c9rl1

Details for d1c9rl2

PDB Entry: 1c9r (more details), 3.5 Å

PDB Description: crystal structure of met184ile mutant of hiv-1 reverse transcriptase in complex with double stranded dna template-primer

SCOP Domain Sequences for d1c9rl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9rl2 b.1.1.2 (L:108-214) Immunoglobulin (constant domains of L and H chains) {Fab 28 against HIV-1 RT (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvawaidgsaaangvlnswtdqd
skdstysmsstltltadeyeaansytcaathktstspivksfnanec

SCOP Domain Coordinates for d1c9rl2:

Click to download the PDB-style file with coordinates for d1c9rl2.
(The format of our PDB-style files is described here.)

Timeline for d1c9rl2: