Lineage for d2hmid2 (2hmi D:124-220)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221239Species Fab 28 against HIV-1 RT (mouse), kappa L chain [49068] (5 PDB entries)
  8. 221241Domain d2hmid2: 2hmi D:124-220 [21275]
    Other proteins in same PDB: d2hmia1, d2hmia2, d2hmib_, d2hmic1, d2hmid1
    protein/protein/DNA complex; mutant

Details for d2hmid2

PDB Entry: 2hmi (more details), 2.8 Å

PDB Description: hiv-1 reverse transcriptase/fragment of fab 28/dna complex

SCOP Domain Sequences for d2hmid2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmid2 b.1.1.2 (D:124-220) Immunoglobulin (constant domains of L and H chains) {Fab 28 against HIV-1 RT (mouse), kappa L chain}
aattppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkki

SCOP Domain Coordinates for d2hmid2:

Click to download the PDB-style file with coordinates for d2hmid2.
(The format of our PDB-style files is described here.)

Timeline for d2hmid2: