SCOPe 2.04: Domain d3l7fa1: 3l7f A:1-107

Lineage for d3l7fa1 (3l7f A:1-107)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d3l7fa1: 3l7f A:1-107 [212749]
   Other proteins in same PDB: d3l7fa2, d3l7fd2, d3l7fl2
   automated match to d1rhha1
   complexed with ca, so4

Details for d3l7fa1

PDB Entry: 3l7f, 2.6 Å

PDB Description: structure of il-13 antibody h2l6, a humanized variant of c836

PDB Compounds: (A:) h2l6 light chain

SCOPe Domain Sequences for d3l7fa1:

Sequence; same for both SEQRES and ATOM records:

>d3l7fa1 b.1.1.0 (A:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlslspgeratlscrasksiskylawyqqkpgqaprlliysgstlqsgipa
rfsgsgsgtdftltisslepedfavyycqqhneypytfgqgtkleik

Timeline for d3l7fa1:

• d3l7fa1 first appeared in SCOPe 2.03
  
• d3l7fa1 appears in SCOPe 2.05
  
• d3l7fa1 appears in the current release, SCOPe 2.08